General Information

  • ID:  hor006142
  • Uniprot ID:  P23362
  • Protein name:  Cholecystokinin-58
  • Gene name:  CCK
  • Organism:  Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0030424 axon

Sequence Information

  • Sequence:  AVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDF
  • Length:  58(46-103)
  • Propeptide:  MNSGVSLCVLMAVLAAGALTQPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
  • Signal peptide:  MNSGVSLCVLMAVLAAGALT
  • Modification:  T52 Sulfotyrosine;T58 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P23362-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006142_AF2.pdbhor006142_ESM.pdb

Physical Information

Mass: 766045 Formula: C286H460N92O85S3
Absent amino acids: C Common amino acids: RA
pI: 10.43 Basic residues: 11
Polar residues: 14 Hydrophobic residues: 18
Hydrophobicity: -69.31 Boman Index: -15526
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.86
Instability Index: 4714.31 Extinction Coefficient cystines: 8480
Absorbance 280nm: 148.77

Literature

  • PubMed ID:  2174979
  • Title:  Patterns of cerebral cortex mRNA expression.